PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M00946.1.p
Common NameLOC105968413, MIMGU_mgv1a023072mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 306aa    MW: 33948.6 Da    PI: 6.2689
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M00946.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.28e-34166223259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s fprsYYrCt+++C vkk+vers +dp++v++tYeg+Hnh+
  Migut.M00946.1.p 166 EDGYRWRKYGQKAVKNSSFPRSYYRCTTQKCGVKKHVERSFQDPSIVITTYEGQHNHH 223
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-35150225IPR003657WRKY domain
SuperFamilySSF1182902.75E-29157225IPR003657WRKY domain
PROSITE profilePS5081131.376160225IPR003657WRKY domain
SMARTSM007742.0E-39165224IPR003657WRKY domain
PfamPF031063.5E-26166223IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MSEDYTQYYY HQPFHGGNTT ATTFHDDDDS TNYFSSSADH HNRLQPPPPQ MFDPSSSYQM  60
SFPGFFNGSN SSADQNSFSG AFAASSDAAA GGGGDQTPAT PNSPISSSST EAAAATAAGE  120
EDSNKGKKED AEDATSKKDG KEEKKKKKQR EERFAFMTKS EVDHLEDGYR WRKYGQKAVK  180
NSSFPRSYYR CTTQKCGVKK HVERSFQDPS IVITTYEGQH NHHLPVTLRG NMSAGIFSPP  240
AEAISNYNNT FIPNNHHQIY GYGSSSDVNN QQQQQQTFVS TQIQQFHQFD DYGALLQDII  300
PKHEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-271582251077Probable WRKY transcription factor 4
2lex_A7e-271582251077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012848492.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLA0A022QHJ90.0A0A022QHJ9_ERYGU; Uncharacterized protein
STRINGVIT_10s0003g02810.t011e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14852475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-46WRKY DNA-binding protein 71